Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H4 receptor (HRH4), partial

This Recombinant Human Histamine H4 receptor (HRH4), partial spans the amino acid sequence from region 194-304aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AXOR35; G-protein coupled receptor 105; GPRv53; Pfi-013; SP9144

UniProt

Q9H3N8

Expression Region

194-304aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITM2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-23312R-PerCP-Cy5.5 100 µL

FITM2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
GSTM4 Antibody Blocking Peptide
orb1511085 500 µg

GSTM4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Maturase K (matK), partial
MBS1428442 Inquire

Recombinant Maturase K (matK), partial

Sign In for Pricing
View Details
Human PSG1/Pregnancy-specific beta-1-glycoprotein 1 ELISA Kit
E2070Hu 96 Tests

Human PSG1/Pregnancy-specific beta-1-glycoprotein 1 ELISA Kit

Sign In for Pricing
View Details
[Nphe1]Nociceptin (1-13) NH2
256029 1 mg

[Nphe1]Nociceptin (1-13) NH2

Sign In for Pricing
View Details
PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (FITC)
131951-FITC 100 µL

PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (FITC)

Sign In for Pricing
View Details