Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1)

This Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1) spans the amino acid sequence from region 1-303aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen NY-CO-7; CLL-associated antigen KW-8; Carboxy terminus of Hsp70-interacting protein; RING-type E3 ubiquitin transferase CHIP; STIP1 homology and U box-containing protein 1

UniProt

Q9UNE7

Expression Region

1-303aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Molecular Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GGACT, His-tagged
GGACT-9183H 25 µg

Recombinant Human GGACT, His-tagged

Sign In for Pricing
View Details
STARD5, 1-213aa, Human, His tag, E.coli
E53A04052 50 µg

STARD5, 1-213aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Cylinders, Measuring, Graduated, TPX
2063180/5 1 Each

Cylinders, Measuring, Graduated, TPX

Sign In for Pricing
View Details
OSBPL5 (NM_001144063) Human Tagged Lenti ORF Clone
RC227756L2 10 µg

OSBPL5 (NM_001144063) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KDM1/LSD1 Rabbit Polyclonal Antibody (Cy3)
orb986446 100 µL

KDM1/LSD1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Carbol Fuchsin Powder For Microscopy
00679 00025 25 g

Carbol Fuchsin Powder For Microscopy

Sign In for Pricing
View Details