Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1)

This Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1) spans the amino acid sequence from region 1-303aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen NY-CO-7; CLL-associated antigen KW-8; Carboxy terminus of Hsp70-interacting protein; RING-type E3 ubiquitin transferase CHIP; STIP1 homology and U box-containing protein 1

UniProt

Q9UNE7

Expression Region

1-303aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Molecular Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Proteinase 3 antibody ELISA Kit
MBS742551-01 48 Well

Sheep Proteinase 3 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Proteinase 3 antibody ELISA Kit
MBS742551-02 96 Well

Sheep Proteinase 3 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Proteinase 3 antibody ELISA Kit
MBS742551-03 5x 96 Well

Sheep Proteinase 3 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Proteinase 3 antibody ELISA Kit
MBS742551-04 10x 96 Well

Sheep Proteinase 3 antibody ELISA Kit

Sign In for Pricing
View Details
PCDH-CMV-FBLEF1A-EGFP-T2A-PURO
BZ0755-2 1 Vial

PCDH-CMV-FBLEF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
Recombinant Human Glypican 1 CF
4519-GP-050 50 µg

Recombinant Human Glypican 1 CF

Sign In for Pricing
View Details