Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 15 (Bmp15)

This Recombinant Mouse Bone morphogenetic protein 15 (Bmp15) spans the amino acid sequence from region 268-392aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth/differentiation factor 9B

UniProt

Q9Z0L4

Expression Region

268-392aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QACSIESDASCPSQEHDGSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTRVLPYGLNSPNHAIIQSLVNELVNHSVPQPSCVPYNFLPMSILLIETNGSILYKEYEGMIAQSCTCR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTAIRE-3 (H-4) FITC
sc-393262 FITC 200 µg/mL

PCTAIRE-3 (H-4) FITC

Sign In for Pricing
View Details
Hsa-miR-224-3p miRNA Mimic
CMH0853-01 5 nmol

Hsa-miR-224-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-224-3p miRNA Mimic
CMH0853-02 10 nmol

Hsa-miR-224-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-01 50 μL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-02 100 µL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-03 1 mL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details