Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial

This Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial spans the amino acid sequence from region 22-108aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain

UniProt

P22646

Expression Region

22-108aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1-Methoxycyclohexyl) methanol
SEA63711-01 50 mg

(1-Methoxycyclohexyl) methanol

Sign In for Pricing
View Details
(1-Methoxycyclohexyl) methanol
SEA63711-02 0.5 g

(1-Methoxycyclohexyl) methanol

Sign In for Pricing
View Details
Cyclin A ELISA Kit
EKA50157 96 Tests

Cyclin A ELISA Kit

Sign In for Pricing
View Details
APOBEC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0105405 3x 1.0 µg

APOBEC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mg29 Lentiviral Activation Particles (h2)
sc-409404-LAC-2 200 µL

Mg29 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Ro 48-8071 fumarate
M12966-01 1 g

Ro 48-8071 fumarate

Sign In for Pricing
View Details