Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs
This Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs spans the amino acid sequence from region 1-220aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
Skullin
UniProt
P56747
Expression Region
1-220aa
Tag
C-terminal mTagBFP2-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Microbiology
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
49.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880204-100 1x 100 µL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details