Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs

This Recombinant Human Claudin-6 (CLDN6), Fluorescent-VLPs spans the amino acid sequence from region 1-220aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Skullin

UniProt

P56747

Expression Region

1-220aa

Tag

C-terminal mTagBFP2-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX58 Rabbit Polyclonal Antibody (BF647)
orb2515841 100 µL

DHX58 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CSPP1 3'UTR Lenti-reporter-Luc Vector
16961081 1.0 µg

CSPP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Astacin Like Metallo Endopeptidase (ASTL) ELISA Kit
RD-ASTL-Hu-48Tests 48 Tests

Human Astacin Like Metallo Endopeptidase (ASTL) ELISA Kit

Sign In for Pricing
View Details
Cow Protein S100-A9 / CAGB (S100A9) Protein
abx166030-01 50 µg

Cow Protein S100-A9 / CAGB (S100A9) Protein

Sign In for Pricing
View Details
Cow Protein S100-A9 / CAGB (S100A9) Protein
abx166030-02 100 µg

Cow Protein S100-A9 / CAGB (S100A9) Protein

Sign In for Pricing
View Details
Cow Protein S100-A9 / CAGB (S100A9) Protein
abx166030-03 200 µg

Cow Protein S100-A9 / CAGB (S100A9) Protein

Sign In for Pricing
View Details