Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin receptor (EPOR), partical

This Recombinant Human Erythropoietin receptor (EPOR), partical spans the amino acid sequence from region 25-250aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPO-R; EPOR

UniProt

P19235

Expression Region

25-250aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Garinii metK Protein (aa 1-392)
VAng-Lsx2083-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Garinii metK Protein (aa 1-392)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Sensor protein torS (torS), partial
MBS1063224 Inquire

Recombinant Escherichia coli O157:H7 Sensor protein torS (torS), partial

Sign In for Pricing
View Details
Ear11 CRISPR/Cas9 KO Plasmid (m)
sc-430033 20 µg

Ear11 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
WAY-639872
T80789-01 5 mg

WAY-639872

Sign In for Pricing
View Details
WAY-639872
T80789-02 50 mg

WAY-639872

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Interleukin 17 (IL17)
MBS2120542-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details