Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 11 (Gdf11)

This Recombinant Mouse Growth/differentiation factor 11 (Gdf11) spans the amino acid sequence from region 297-405aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 11

UniProt

Q9Z1W4

Expression Region

297-405aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)
TRV-0044119-01 20 µL

Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)
TRV-0044119-02 100 µL

Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)
TRV-0044119-03 200 µL

Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)
TRV-0044119-04 1 mL

Polyclonal Antibody to Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
RRAS2 (Ras-related Protein R-Ras2, TC21) discontinued
213205-01 50 µL

RRAS2 (Ras-related Protein R-Ras2, TC21) discontinued

Sign In for Pricing
View Details
RRAS2 (Ras-related Protein R-Ras2, TC21) discontinued
213205-02 100 µL

RRAS2 (Ras-related Protein R-Ras2, TC21) discontinued

Sign In for Pricing
View Details