Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 9 (Gdf9)

This Recombinant Mouse Growth/differentiation factor 9 (Gdf9) spans the amino acid sequence from region 307-441aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-9; Gdf-9

UniProt

Q07105

Expression Region

307-441aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

84.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RCC1 Antibody (R1Q93)
RHD30602 100 μg

Anti-RCC1 Antibody (R1Q93)

Sign In for Pricing
View Details
Zebrafish PAX2a/b Rabbit Polyclonal Antibody (Fluoro594)
orb3089461 100 µg

Zebrafish PAX2a/b Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
ARFRP1 (Biotin)
555380-01 50 µg

ARFRP1 (Biotin)

Sign In for Pricing
View Details
ARFRP1 (Biotin)
555380-02 100 µg

ARFRP1 (Biotin)

Sign In for Pricing
View Details
Olfr474 ORF Vector (Mouse) (pORF)
ORF052651 1.0 µg DNA

Olfr474 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Nucleolar complex protein 2 homolog (NOC2L) Bovine ELISA Kit
F4856 96 Tests

Nucleolar complex protein 2 homolog (NOC2L) Bovine ELISA Kit

Sign In for Pricing
View Details