Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 9 (Gdf9)

This Recombinant Mouse Growth/differentiation factor 9 (Gdf9) spans the amino acid sequence from region 307-441aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-9; Gdf-9

UniProt

Q07105

Expression Region

307-441aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

84.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQKAIRSEAKGPLLTASFNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEXT13 Prestained Protein Ladder
BPMX13-0500 500 μL

NEXT13 Prestained Protein Ladder

Sign In for Pricing
View Details
Dnmt3b Recombinant Rabbit Monoclonal Antibody
orb1816770-01 50 µL

Dnmt3b Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Dnmt3b Recombinant Rabbit Monoclonal Antibody
orb1816770-02 100 µL

Dnmt3b Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
STAU2 Antibody
orb1257874 100 µL

STAU2 Antibody

Sign In for Pricing
View Details
Recombinant Human Keratin, type II cytoskeletal 78 (KRT78)
MBS1377053-01 0.02 mg (E-Coli)

Recombinant Human Keratin, type II cytoskeletal 78 (KRT78)

Sign In for Pricing
View Details
Recombinant Human Keratin, type II cytoskeletal 78 (KRT78)
MBS1377053-02 0.02 mg (Yeast)

Recombinant Human Keratin, type II cytoskeletal 78 (KRT78)

Sign In for Pricing
View Details