Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon beta (Ifnb1)

This Recombinant Mouse Interferon beta (Ifnb1) spans the amino acid sequence from region 22-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-beta; Ifnb1; Ifb, Ifnb

UniProt

P01575

Expression Region

22-182aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-Heneicosanol
FH35769-01 25 g

11-Heneicosanol

Sign In for Pricing
View Details
11-Heneicosanol
FH35769-02 50 g

11-Heneicosanol

Sign In for Pricing
View Details
11-Heneicosanol
FH35769-03 100 g

11-Heneicosanol

Sign In for Pricing
View Details
P75 NGF Receptor (NGFR) (NM_002507) Human Over-expression Lysate
LS004804-20ug 20 µg

P75 NGF Receptor (NGFR) (NM_002507) Human Over-expression Lysate

Sign In for Pricing
View Details
NR1D2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2461802 100 µL

NR1D2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
KRT8P45 Protein Vector (Human) (pPM-C-HA)
PV089968 500 ng

KRT8P45 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details