Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

This Recombinant Macaca mulatta Interferon gamma (IFNG) (Active) spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma; IFN-gamma; IFNG

UniProt

P63310

Expression Region

24-165aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody. The EC50 is 35.23-38.98 ng/mL.

Form

Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 Mouse Monoclonal Antibody (PE/Cy7)
orb1293551-01 25 assay

CD8 Mouse Monoclonal Antibody (PE/Cy7)

Sign In for Pricing
View Details
CD8 Mouse Monoclonal Antibody (PE/Cy7)
orb1293551-02 100 assay

CD8 Mouse Monoclonal Antibody (PE/Cy7)

Sign In for Pricing
View Details
Anti-FAM149A Antibody
CTA1911-01 30 µL

Anti-FAM149A Antibody

Sign In for Pricing
View Details
Anti-FAM149A Antibody
CTA1911-02 50 μL

Anti-FAM149A Antibody

Sign In for Pricing
View Details
Anti-FAM149A Antibody
CTA1911-03 100 µL

Anti-FAM149A Antibody

Sign In for Pricing
View Details
Anti-FAM149A Antibody
CTA1911-04 200 µL

Anti-FAM149A Antibody

Sign In for Pricing
View Details