Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

This Recombinant Macaca mulatta Interferon gamma (IFNG) (Active) spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma; IFN-gamma; IFNG

UniProt

P63310

Expression Region

24-165aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody. The EC50 is 35.23-38.98 ng/mL.

Form

Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reptin, CT (RuvB-like 2, 48kD TATA Box-binding Protein-interacting Protein, 48kD TBP-Interacting Protein, TIP49b, Repressing Pontin 52, Reptin 52, 51kD Erythrocyte Cytosolic Protein, ECP-51, TIP60-associated Protein 54-beta, TAP54-beta, TIP48, TIP49B, RUVBL2, INO80J, CGI-46) (PE) discontinued
R9931-16A-PE 200 µL

Reptin, CT (RuvB-like 2, 48kD TATA Box-binding Protein-interacting Protein, 48kD TBP-Interacting Protein, TIP49b, Repressing Pontin 52, Reptin 52, 51kD Erythrocyte Cytosolic Protein, ECP-51, TIP60-associated Protein 54-beta, TAP54-beta, TIP48, TIP49B, RUVBL2, INO80J, CGI-46) (PE) discontinued

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone 4A12]
E45M21689V-2 50 µL

IL17 (IL17A) Mouse Monoclonal Antibody [Clone 4A12]

Sign In for Pricing
View Details
THOC3 Antibody; Biotin conjugated
MBS7005366-01 0.05 mg

THOC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
THOC3 Antibody; Biotin conjugated
MBS7005366-02 0.1 mg

THOC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
THOC3 Antibody; Biotin conjugated
MBS7005366-03 5x 0.1 mg

THOC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
SRT1720 10mg
A10862-10 10 mg

SRT1720 10mg

Sign In for Pricing
View Details