Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated

This Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; IFNG

UniProt

P63310

Expression Region

24-165aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A1 Rabbit pAb
E2514787 100 µL

SRD5A1 Rabbit pAb

Sign In for Pricing
View Details
IRF3 (Ab-396) Antibody
A73709-100UL 100 µL

IRF3 (Ab-396) Antibody

Sign In for Pricing
View Details
ACVR2A ELISA Kit (Mouse)
OKEH01975-96W 96 Tests

ACVR2A ELISA Kit (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Eapp shRNA (UAS) - Lentiviral mouse Eapp shRNA (UAS) (25)
GTR15180005 1 Vial

Lentiviral mouse Eapp shRNA (UAS) - Lentiviral mouse Eapp shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Esophagus PrimaCell™2: Normal Esophageal Smooth Muscle Cells
2-82036 1 Kit

Mouse Esophagus PrimaCell™2: Normal Esophageal Smooth Muscle Cells

Sign In for Pricing
View Details
AKT1S1 Recombinant Antibody, PerCP Conjugated
bsm-61149R-PerCP-01 20 µL

AKT1S1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details