Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Insulin-like growth factor 1 (Igf1)

This Recombinant Mouse Insulin-like growth factor 1 (Igf1) spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I; Somatomedin

UniProt

P05017

Expression Region

49-118aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cy5.5 Anti-human CD8 Antibody *OKT-8*
100821U2-AAT 500 Tests

PerCP/Cy5.5 Anti-human CD8 Antibody *OKT-8*

Sign In for Pricing
View Details
PPP1R14BP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37414151 3x 1.0 µg DNA

PPP1R14BP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (PE) discontinued
036176-PE 200 µL

GOT1, CT (GOT1, Aspartate aminotransferase, cytoplasmic, Glutamate oxaloacetate transaminase 1, Transaminase A) (PE) discontinued

Sign In for Pricing
View Details
FADS3 (NM_021727) Human Tagged ORF Clone Lentiviral Particle
RC201302L4V 200 µL

FADS3 (NM_021727) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TTBK1 (NM_032538) Human Mass Spec Standard
PH314874 10 µg

TTBK1 (NM_032538) Human Mass Spec Standard

Sign In for Pricing
View Details
Phospho-MEK5 (Ser129) Rabbit Polyclonal Antibody (APC)
orb993896 100 µL

Phospho-MEK5 (Ser129) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details