Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-9 (LGALS9), partial, Biotinylated

This Recombinant Human Galectin-9 (LGALS9), partial, Biotinylated spans the amino acid sequence from region 2-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ecalectin; Tumor antigen HOM-HD-21

UniProt

O00182

Expression Region

2-323aa

Tag

N-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sema4a (NM_001012078) Rat Tagged ORF Clone
RR209946 10 µg

Sema4a (NM_001012078) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Canine Olfactory receptor 4Q3 (OR4Q3) ELISA kit
GTR10451103 96 Well

Canine Olfactory receptor 4Q3 (OR4Q3) ELISA kit

Sign In for Pricing
View Details
mmu-miR-8107 miRNA Agomir
MBS8315165-01 5 nmol

mmu-miR-8107 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-8107 miRNA Agomir
MBS8315165-02 10 nmol

mmu-miR-8107 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-8107 miRNA Agomir
MBS8315165-03 20 nmol

mmu-miR-8107 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-8107 miRNA Agomir
MBS8315165-04 5x 20 nmol

mmu-miR-8107 miRNA Agomir

Sign In for Pricing
View Details