Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Napsin-A (Napsa)

This Recombinant Mouse Napsin-A (Napsa) spans the amino acid sequence from region 17-419aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KDAP-1; Kidney-derived aspartic protease-like protein

UniProt

O09043

Expression Region

17-419aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPEEAKLIRVPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNPSFVPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLARAQSRSTDRAERRTTQAQFFKRRPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRPB1 Antibody, FITC conjugated
A57898-100UG 100 µg

SIRPB1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, IMP-aspartate ligase 1) (MaxLight 490) discontinued
031666-ML490 100 µL

ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, IMP-aspartate ligase 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_532 Protein (aa 1-282)
VAng-Lsx05026-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_532 Protein (aa 1-282)

Sign In for Pricing
View Details
LRRC31 CRISPRa sgRNA lentivector (set of three targets)(Human)
27641121 3x 1.0µg DNA

LRRC31 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human MMP-1 Protein (Halo Tag)
PDMH100468-01 20 µg

Recombinant Human MMP-1 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Human MMP-1 Protein (Halo Tag)
PDMH100468-02 100 µg

Recombinant Human MMP-1 Protein (Halo Tag)

Sign In for Pricing
View Details