Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

This Recombinant Human Glucocorticoid receptor (NR3C1), partial spans the amino acid sequence from region 521-777aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 1

UniProt

P04150

Expression Region

521-777aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

99.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4IN1 Rapid Test Strip (Sulfonamides+Tetracyclines+Cefalexin+β-Lactames)
SC-RP-077 96 Tests

4IN1 Rapid Test Strip (Sulfonamides+Tetracyclines+Cefalexin+β-Lactames)

Sign In for Pricing
View Details
Leupaxin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13653R-BF647 100 µL

Leupaxin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Tryptase gamma-1/TPSG1 Antibody (OTI1E11) [PE/Atto594]
NBP2-74649PEATT594 0.1 mL

Mouse Monoclonal Tryptase gamma-1/TPSG1 Antibody (OTI1E11) [PE/Atto594]

Sign In for Pricing
View Details
Human MSP1D1 Protein, His Tag (Nanodisc)
APO-H51H3-150ug 150 µg

Human MSP1D1 Protein, His Tag (Nanodisc)

Sign In for Pricing
View Details
Teprotumumab Biosimilar - Research Grade
ICH5128-1g 1 g

Teprotumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
MAPK9 Recombinant Protein (Human)
OPCA03900-100UG 100 µg

MAPK9 Recombinant Protein (Human)

Sign In for Pricing
View Details