Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Slit homolog 2 protein (SLIT2), partial

This Recombinant Human Slit homolog 2 protein (SLIT2), partial spans the amino acid sequence from region 271-480aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLIT2; SLIL3

UniProt

O94813

Expression Region

271-480aa

Tag

C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Cycloheptanedione
TRC-C987255-100MG 100 mg

1,2-Cycloheptanedione

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF568 conjugate, 0.1mg/mL
BNC683056-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PBP (PEBP1) Human Gene Knockout Kit (CRISPR)
KN206355LP 1 Kit

PBP (PEBP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF568 conjugate, 0.1mg/mL
BNC682968-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aniline 4-Hydroxylase Microplate Assay Kit
RDSM032 100 Assays

Aniline 4-Hydroxylase Microplate Assay Kit

Sign In for Pricing
View Details
KCNIP1 (NM_001278340) Human Tagged ORF Clone
RG236403 10 µg

KCNIP1 (NM_001278340) Human Tagged ORF Clone

Sign In for Pricing
View Details