Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tgfb1

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN16, ID (ZSCAN16, ZNF392, ZNF435, Zinc finger and SCAN domain-containing protein 16, Zinc finger protein 392, Zinc finger protein 435) (MaxLight 650)
MBS6368172-01 0.1 mL

ZSCAN16, ID (ZSCAN16, ZNF392, ZNF435, Zinc finger and SCAN domain-containing protein 16, Zinc finger protein 392, Zinc finger protein 435) (MaxLight 650)

Sign In for Pricing
View Details
ZSCAN16, ID (ZSCAN16, ZNF392, ZNF435, Zinc finger and SCAN domain-containing protein 16, Zinc finger protein 392, Zinc finger protein 435) (MaxLight 650)
MBS6368172-02 5x 0.1 mL

ZSCAN16, ID (ZSCAN16, ZNF392, ZNF435, Zinc finger and SCAN domain-containing protein 16, Zinc finger protein 392, Zinc finger protein 435) (MaxLight 650)

Sign In for Pricing
View Details
RlmL Antibody
orb826897 2 mg

RlmL Antibody

Sign In for Pricing
View Details
CPN2 Rabbit pAb
E47R9907 100 µL

CPN2 Rabbit pAb

Sign In for Pricing
View Details
Mouse SPAG6 siRNA
abx934795-01 15 nmol

Mouse SPAG6 siRNA

Sign In for Pricing
View Details
Mouse SPAG6 siRNA
abx934795-02 30 nmol

Mouse SPAG6 siRNA

Sign In for Pricing
View Details