Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)

This Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active) spans the amino acid sequence from region 80-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a) ; Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF) ; Intracellular domain 1 (ICD1) ; Intracellular domain 2 (ICD2) ; C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

UniProt

P06804

Expression Region

80-235aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RRM1 Protein, N-His
orb2836148-01 20 µg

Recombinant Human RRM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RRM1 Protein, N-His
orb2836148-02 50 µg

Recombinant Human RRM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RRM1 Protein, N-His
orb2836148-03 100 µg

Recombinant Human RRM1 Protein, N-His

Sign In for Pricing
View Details
Mouse Monoclonal SEPHS1 Antibody (3G3)
H00022929-M04 0.1 mg

Mouse Monoclonal SEPHS1 Antibody (3G3)

Sign In for Pricing
View Details
RPL29P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV779352 1.0 µg DNA

RPL29P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Histone H1.4 Polyclonal Antibody
RD89326A-01 60 μL

Histone H1.4 Polyclonal Antibody

Sign In for Pricing
View Details