Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial

This Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial spans the amino acid sequence from region 49-198aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OX40 ligand

UniProt

P43488

Expression Region

49-198aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK1 Human Gene Knockout Kit (CRISPR)
KN215643LP 1 Kit

ULK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CDH20 activation kit by CRISPRa
GA109158 1 Kit

Human CDH20 activation kit by CRISPRa

Sign In for Pricing
View Details
SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)
KN204404RB 1 Kit

SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crebbp Mouse Gene Knockout Kit (CRISPR)
KN303812 1 Kit

Crebbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARL2 Human Gene Knockout Kit (CRISPR)
KN400501 1 Kit

ARL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ubiquitin Antibody
F42055-0.08ML 0.08 mL

Ubiquitin Antibody

Sign In for Pricing
View Details