Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis CD226 antigen (CD226), partial, Biotinylated

This Recombinant Macaca fascicularis CD226 antigen (CD226), partial, Biotinylated spans the amino acid sequence from region 19-247aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD226

UniProt

A0A2K5W1Z6

Expression Region

19-247aa

Tag

C-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKVQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACAN Protein, N-His
YHD15201 100 μg

Recombinant Human ACAN Protein, N-His

Sign In for Pricing
View Details
Anti-Mouse CD31 (PECAM) FITC
RM313130 50 Tests

Anti-Mouse CD31 (PECAM) FITC

Sign In for Pricing
View Details
Cadherin-16 Polyclonal Antibody
E20-70594 100 µg

Cadherin-16 Polyclonal Antibody

Sign In for Pricing
View Details
Roll of 100 m of non woven filter 35g/m², l = 500 mm
NT35R0500/100 Roll of 100

Roll of 100 m of non woven filter 35g/m², l = 500 mm

Sign In for Pricing
View Details
SENP5 Polyclonal Antibody, Biotin Conjugated
bs-8464R-Biotin 100 µL

SENP5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
L3HYPDH Peptide - C-terminal region
MBS3243001-01 0.1 mg

L3HYPDH Peptide - C-terminal region

Sign In for Pricing
View Details