Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Anti-Muellerian hormone type-2 receptor (Amhr2), partial

This Recombinant Mouse Anti-Muellerian hormone type-2 receptor (Amhr2), partial spans the amino acid sequence from region 16-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-Muellerian hormone type II receptor; MIS type II receptor

UniProt

Q8K592

Expression Region

16-147aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUFIP1 Protein Vector (Rat) (pPM-C-HA)
32309026 500 ng

NUFIP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal L1CAM Antibody (UJ181.4) [DyLight 755]
NB100-2683IR 0.1 mL

Mouse Monoclonal L1CAM Antibody (UJ181.4) [DyLight 755]

Sign In for Pricing
View Details
Sonic Hedgehog Protein/SHH (C-Product) Rabbit Monoclonal Antibody
AF2044 50 µL

Sonic Hedgehog Protein/SHH (C-Product) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL
BNCB1620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NOX1 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 1, MOX1, GP91-2, NOH1, NADPH Oxidase 1, Mitogenic Oxidase (Pyridine Nucleotide-Dependent Superoxide-Generating, NADH/NADPH mitogenic oxidase subunit P65-MOX)
364402 200 µL

NOX1 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 1, MOX1, GP91-2, NOH1, NADPH Oxidase 1, Mitogenic Oxidase (Pyridine Nucleotide-Dependent Superoxide-Generating, NADH/NADPH mitogenic oxidase subunit P65-MOX)

Sign In for Pricing
View Details
LOC100360752 3'UTR Luciferase Stable Cell Line
TU207699 1.0 mL

LOC100360752 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details