Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial

This Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial spans the amino acid sequence from region 1-40aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mrgprb2

UniProt

Q3KNA1

Expression Region

1-40aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI16 (FAM160B2) (NM_022749) Human 3' UTR Clone
SC214789 10 µg

RAI16 (FAM160B2) (NM_022749) Human 3' UTR Clone

Sign In for Pricing
View Details
Rat Annexin A1 ELISA kit
GTR10462418 96 Well

Rat Annexin A1 ELISA kit

Sign In for Pricing
View Details
TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein) (MaxLight 650)
MBS6353597-01 0.1 mL

TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein) (MaxLight 650)

Sign In for Pricing
View Details
TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein) (MaxLight 650)
MBS6353597-02 5x 0.1 mL

TARBP2, NT (TARBP2, TRBP, RISC-loading complex subunit TARBP2, TAR RNA-binding protein 2, Trans-activation-responsive RNA-binding protein) (MaxLight 650)

Sign In for Pricing
View Details
Monoclonal Antibody to Pulmonary Activation Regulated Chemokine (PARC)
MBS2025798-01 0.1 mL

Monoclonal Antibody to Pulmonary Activation Regulated Chemokine (PARC)

Sign In for Pricing
View Details
Monoclonal Antibody to Pulmonary Activation Regulated Chemokine (PARC)
MBS2025798-02 0.2 mL

Monoclonal Antibody to Pulmonary Activation Regulated Chemokine (PARC)

Sign In for Pricing
View Details