Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2), partial

This Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2), partial spans the amino acid sequence from region 34-223aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gp42

UniProt

P0C6Z5

Expression Region

34-223aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCGF1 Antibody, FITC conjugated
A66903-50UG 50 µg

PCGF1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Rat Glutamate carboxypeptidase 2 (Folh1)
orb2901973-01 20 µg

Recombinant Rat Glutamate carboxypeptidase 2 (Folh1)

Sign In for Pricing
View Details
Recombinant Rat Glutamate carboxypeptidase 2 (Folh1)
orb2901973-02 100 µg

Recombinant Rat Glutamate carboxypeptidase 2 (Folh1)

Sign In for Pricing
View Details
FAM178B Lentiviral Activation Particles (m2)
sc-436271-LAC-2 200 µL

FAM178B Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Anti HCV NS3 Mab
181047 100 µg

Anti HCV NS3 Mab

Sign In for Pricing
View Details
ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI9F9]
TA809543 100 µL

ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI9F9]

Sign In for Pricing
View Details