Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Uncharacterized protein

This Recombinant Prunus persica Uncharacterized protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

M5XYM8

Expression Region

1-305aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAVTKSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQSSSSYLPTTLSSQNSASPSLSPNCSAPSISLPTSPPSKVSQIFDHPINGNSSSVTSPSIFSSDSLISQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGPNLDPASAICDFDNQQFDCQMTAGDWMLDNMTDTLWNMEGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE-A6 Double Nickase Plasmid (h2)
sc-402768-NIC-2 20 µg

MAGE-A6 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
MAP3K5, CT (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (AP) discontinued
M2867-52F-AP 100 µL

MAP3K5, CT (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (AP) discontinued

Sign In for Pricing
View Details
HPV16 L1/Major capsid Polyclonal Antibody L1 Polyclonal Antibody
E55A04566 100 µg

HPV16 L1/Major capsid Polyclonal Antibody L1 Polyclonal Antibody

Sign In for Pricing
View Details
Susd4 (NM_144796) Mouse Tagged ORF Clone
MG207846 10 µg

Susd4 (NM_144796) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BDE 24 [CAS:NA] 10ug/ml in Iso-octane
BDE2401ZT10 10 mL

BDE 24 [CAS:NA] 10ug/ml in Iso-octane

Sign In for Pricing
View Details
Rabbit Polyclonal RSK1 Antibody [DyLight 488]
NBP1-76620G 0.1 mL

Rabbit Polyclonal RSK1 Antibody [DyLight 488]

Sign In for Pricing
View Details