Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Uncharacterized protein

This Recombinant Prunus persica Uncharacterized protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

M5XYM8

Expression Region

1-305aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAVTKSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQSSSSYLPTTLSSQNSASPSLSPNCSAPSISLPTSPPSKVSQIFDHPINGNSSSVTSPSIFSSDSLISQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGPNLDPASAICDFDNQQFDCQMTAGDWMLDNMTDTLWNMEGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nα-Fmoc- N-δ-trityl-L-glutamine 4-alkoxybenzyl alcohol resin
sc-476038A 5 g

Nα-Fmoc- N-δ-trityl-L-glutamine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Glucosamine-6-phosphate isomerase 2 (GNPDA2) Human ELISA Kit
D7072 96 Tests

Glucosamine-6-phosphate isomerase 2 (GNPDA2) Human ELISA Kit

Sign In for Pricing
View Details
TMEM38A Over-expression Lysate Product
GWB-566000 0.1 mg

TMEM38A Over-expression Lysate Product

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA801787 100 µL

MDM2 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Hepatitis B Virus Receptor Binding Fragment Pre S (HBV L-Protein) Antibody
abx411405 1 mL

Hepatitis B Virus Receptor Binding Fragment Pre S (HBV L-Protein) Antibody

Sign In for Pricing
View Details
Olfr948 ORF Vector (Mouse) (pORF)
33568014 1.0 µg DNA

Olfr948 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details