Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prunus persica Uncharacterized protein

This Recombinant Prunus persica Uncharacterized protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

M5XYM8

Expression Region

1-305aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Prunus persica (Peach) (Amygdalus persica)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAVTKSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQSSSSYLPTTLSSQNSASPSLSPNCSAPSISLPTSPPSKVSQIFDHPINGNSSSVTSPSIFSSDSLISQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGPNLDPASAICDFDNQQFDCQMTAGDWMLDNMTDTLWNMEGM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slu7 (NM_148673) Mouse Untagged Clone
MC228384 10 µg

Slu7 (NM_148673) Mouse Untagged Clone

Sign In for Pricing
View Details
Tmx4 3'UTR Luciferase Stable Cell Line
TU222218 1.0 mL

Tmx4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GLUD1 Antibody
orb3053235-01 50 µL

GLUD1 Antibody

Sign In for Pricing
View Details
GLUD1 Antibody
orb3053235-02 100 µL

GLUD1 Antibody

Sign In for Pricing
View Details
Plectin Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3640R-APC-Cy5.5 100 µL

Plectin Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1318895 Inquire

Recombinant Pseudomonas aeruginosa DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details