Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia marcescens Nuclease (nucA)

This Recombinant Serratia marcescens Nuclease (nucA) spans the amino acid sequence from region 23-266aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endonuclease

UniProt

P13717

Expression Region

23-266aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Serratia marcescens

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GIT2 Antibody [Alexa Fluor 750]
NBP1-19143AF750 0.1 mL

Rabbit Polyclonal GIT2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
ATG16L1 Protein Vector (Human) (pPB-His-MBP)
PV324754 500 ng

ATG16L1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified
MBS3904995-01 0.01 mg

Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified
MBS3904995-02 0.1 mg

Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified
MBS3904995-03 5x 0.01 mg

Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified
MBS3904995-04 5x 0.1 mg

Rabbit anti-BAIAP2L1/IRTKS Antibody, Affinity Purified

Sign In for Pricing
View Details