Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA), partial

This Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA), partial spans the amino acid sequence from region 20-151aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein-tyrosine phosphatase alpha; R-PTP-alpha

UniProt

P18433

Expression Region

20-151aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMF1 (C-term) Rabbit Polyclonal Antibody
AP54107PU-N 400 µL

SUMF1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-UNEL-H0346-01 5x 96 Tests

Uncoated Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-UNEL-H0346-02 15x 96 Tests

Uncoated Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-36656-01 50 μL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-36656-02 100 µL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-36656-03 1 mL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details