Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA), partial

This Recombinant Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA), partial spans the amino acid sequence from region 20-151aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein-tyrosine phosphatase alpha; R-PTP-alpha

UniProt

P18433

Expression Region

20-151aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni groS Protein (aa 1-86) (strain 81-176)
VAng-Ly2157-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni groS Protein (aa 1-86) (strain 81-176)

Sign In for Pricing
View Details
CD9P1 Protein, Human, Recombinant (C-His)
E51P02004 100 µg

CD9P1 Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details
ODF3 Rabbit Polyclonal Antibody (Fluoro594)
orb3093646 100 µg

ODF3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
GABRA2 Polyclonal Antibody, PE-Cy7 Conjugated
bs-12061R-PE-Cy7 100 µL

GABRA2 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
JNJ16259685
T5512-01 1 mg

JNJ16259685

Sign In for Pricing
View Details
JNJ16259685
T5512-02 2 mg

JNJ16259685

Sign In for Pricing
View Details