Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active)

This Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial (Active) spans the amino acid sequence from region 33-262aa. Purity: Greater than 90% as determined by SEC-HPLC. Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1; CSF-1; MCSF; Proteoglycan macrophage colony-stimulating factor; Cleaved into 2 chains Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; Csf1; Csfm

UniProt

P07141

Expression Region

33-262aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SEC-HPLC. Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 at 2 μg/mL can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL.

Form

Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)
MBS7021442-01 0.02 mg

Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)

Sign In for Pricing
View Details
Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)
MBS7021442-02 0.1 mg

Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)

Sign In for Pricing
View Details
Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)
MBS7021442-03 5x 0.1 mg

Recombinant Salmo trutta ATP synthase subunit a (mt-atp6)

Sign In for Pricing
View Details
Chicken Calcium uptake protein 1, mitochondrial (CBARA1) ELISA kit
GTR10454626 96 Well

Chicken Calcium uptake protein 1, mitochondrial (CBARA1) ELISA kit

Sign In for Pricing
View Details
NOSIP (NM_015953) Human Untagged Clone
SC108090 10 µg

NOSIP (NM_015953) Human Untagged Clone

Sign In for Pricing
View Details
Secretogranin V (SCG5), Recombinant, Human, His-Tag
054952-01 10 µg

Secretogranin V (SCG5), Recombinant, Human, His-Tag

Sign In for Pricing
View Details