Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)

This Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active) spans the amino acid sequence from region 19-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Natural cytotoxicity triggering receptor 3; Activating natural killer receptor p30; Natural killer cell p30-related protein (NK-p30; NKp30) ; CD337; NCR3;1C7, LY117

UniProt

O14931

Expression Region

19-135aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human NCR3 at 5 μg/mL can bind human NCR3LG1. The EC50 is 111.3-303.1 ng/mL.

Form

Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uvinul 3030
TRC-U850303-5G 5 g

Uvinul 3030

Sign In for Pricing
View Details
4-Biphenylyl Sulfate Potassium Salt
TRC-B397900-50MG 50 mg

4-Biphenylyl Sulfate Potassium Salt

Sign In for Pricing
View Details
Filamin A (Ab-2152) Antibody
8B0072-AAT 50 µg

Filamin A (Ab-2152) Antibody

Sign In for Pricing
View Details
a-Cellulose (powdered)
TRC-C459200-500G 500 g

a-Cellulose (powdered)

Sign In for Pricing
View Details
Myosin Light Chain 2 (MYL2) Mouse Monoclonal Antibody [Clone ID: 7C9]
AM06318SU-N 100 µL

Myosin Light Chain 2 (MYL2) Mouse Monoclonal Antibody [Clone ID: 7C9]

Sign In for Pricing
View Details
SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G5]
TA504723BM 100 µL

SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G5]

Sign In for Pricing
View Details