Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

This Recombinant Human Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EGF

UniProt

P01133

Expression Region

971-1023aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBIL2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1423204 1.0 µg DNA

NFKBIL2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC25A13 Antibody
CSB-PA892444ESR2HU-01 50 μL

SLC25A13 Antibody

Sign In for Pricing
View Details
SLC25A13 Antibody
CSB-PA892444ESR2HU-02 100 µL

SLC25A13 Antibody

Sign In for Pricing
View Details
USP2 (Ubiquitin Carboxyl-terminal Hydrolase 2, Ubiquitin Specific Peptidase 2)
495267 100 µL

USP2 (Ubiquitin Carboxyl-terminal Hydrolase 2, Ubiquitin Specific Peptidase 2)

Sign In for Pricing
View Details
WFS1 Protein Vector (Human) (pPM-C-HA)
50416021 500 ng

WFS1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PHA-665752
MBS578696 Inquire

PHA-665752

Sign In for Pricing
View Details