Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

This Recombinant Human Ciliary neurotrophic factor (CNTF) spans the amino acid sequence from region 1-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNTF

UniProt

P26441

Expression Region

1-200aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glut2 Phycoerythrin MAb (Clone 199017)
FAB1414P 100 Tests

Human Glut2 Phycoerythrin MAb (Clone 199017)

Sign In for Pricing
View Details
GBD2-set siRNA/shRNA/RNAi Lentivector (Human)
21348091 4x 500 ng

GBD2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Dexi (NM_001109026) Rat Untagged Clone
RN211184 10 µg

Dexi (NM_001109026) Rat Untagged Clone

Sign In for Pricing
View Details
Ctnnb1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4879004 1.0 µg DNA

Ctnnb1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-HA1 (A/Beijing/262/95) (H1N1)
IT-003-00110M2-01 0.1 mg

Anti-HA1 (A/Beijing/262/95) (H1N1)

Sign In for Pricing
View Details
Anti-HA1 (A/Beijing/262/95) (H1N1)
IT-003-00110M2-02 0.5 mg

Anti-HA1 (A/Beijing/262/95) (H1N1)

Sign In for Pricing
View Details