Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukemia inhibitory factor (Lif)

This Recombinant Rat Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 23-202aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Cholinergic neuronal differentiation factor

UniProt

P17777

Expression Region

23-202aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RQCD1, ID (RQCD1, CNOT9, RCD1, Cell differentiation protein RCD1 homolog, CCR4-NOT transcription complex subunit 9) (PE)
MBS6344028-01 0.2 mL

RQCD1, ID (RQCD1, CNOT9, RCD1, Cell differentiation protein RCD1 homolog, CCR4-NOT transcription complex subunit 9) (PE)

Sign In for Pricing
View Details
RQCD1, ID (RQCD1, CNOT9, RCD1, Cell differentiation protein RCD1 homolog, CCR4-NOT transcription complex subunit 9) (PE)
MBS6344028-02 5x 0.2 mL

RQCD1, ID (RQCD1, CNOT9, RCD1, Cell differentiation protein RCD1 homolog, CCR4-NOT transcription complex subunit 9) (PE)

Sign In for Pricing
View Details
Canrenone
254872 50 mg

Canrenone

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glucose Transporter 14 (GLUT14)
TRV-0024483-01 200 µL

Biotin-Linked Polyclonal Antibody to Glucose Transporter 14 (GLUT14)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Glucose Transporter 14 (GLUT14)
TRV-0024483-02 1 mL

Biotin-Linked Polyclonal Antibody to Glucose Transporter 14 (GLUT14)

Sign In for Pricing
View Details
CHU (N6) MicroelementsSolution (100X)
PL 1002-01 1x 100 mL

CHU (N6) MicroelementsSolution (100X)

Sign In for Pricing
View Details