Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukemia inhibitory factor (Lif)

This Recombinant Rat Leukemia inhibitory factor (Lif) spans the amino acid sequence from region 23-202aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LIF; Cholinergic neuronal differentiation factor

UniProt

P17777

Expression Region

23-202aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP7, NT (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (MaxLight 490)
MBS6473194-01 0.1 mL

DUSP7, NT (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (MaxLight 490)

Sign In for Pricing
View Details
DUSP7, NT (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (MaxLight 490)
MBS6473194-02 5x 0.1 mL

DUSP7, NT (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (MaxLight 490)

Sign In for Pricing
View Details
Slc25a37 ORF Vector (Mouse) (pORF)
44021014 1.0 µg DNA

Slc25a37 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Neuropeptide W-23 / L8 (Human) - Rhodamine Labeled
FR-005-60 1 nmol

Neuropeptide W-23 / L8 (Human) - Rhodamine Labeled

Sign In for Pricing
View Details
CD74 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-60795R-BF555 100 µL

CD74 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Goat Anti-Alpha 1-Antitrypsin polyclonal antibody
CABT-BL106 1.0 mg

Goat Anti-Alpha 1-Antitrypsin polyclonal antibody

Sign In for Pricing
View Details