Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

This Recombinant Human Early activation antigen CD69 (CD69), partial spans the amino acid sequence from region 62-199aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

UniProt

Q07108

Expression Region

62-199aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom1r102 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7330305 3x 1.0 µg

Vom1r102 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Accn5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6916805 3x 1.0 µg

Accn5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
OVCA2 Rabbit Polyclonal Antibody
E28PN8146 100 µL

OVCA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
26-Hydroxy Cabotegravir-d3
421454-01 500 µg

26-Hydroxy Cabotegravir-d3

Sign In for Pricing
View Details
26-Hydroxy Cabotegravir-d3
421454-02 1 mg

26-Hydroxy Cabotegravir-d3

Sign In for Pricing
View Details
D,L-alpha-Aminopimelic Acid-d6
TRC-A627902-100MG 100 mg

D,L-alpha-Aminopimelic Acid-d6

Sign In for Pricing
View Details