Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

This Recombinant Mouse Toll-like receptor 7 (Tlr7), partial spans the amino acid sequence from region 27-348aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P58681

Expression Region

27-348aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl6ip6 Mouse Gene Knockout Kit (CRISPR)
KN501582 1 Kit

Arl6ip6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB3A Goat Polyclonal Antibody
AB10032-200 600 µg

RAB3A Goat Polyclonal Antibody

Sign In for Pricing
View Details
alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: 6E6]
AM06377PU-N 100 µL

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: 6E6]

Sign In for Pricing
View Details
Human IL-33 Recombinant Rabbit Monoclonal Antibody [PSH03-06] - BSA and Azide free (Detector)
HA721936 100 µL

Human IL-33 Recombinant Rabbit Monoclonal Antibody [PSH03-06] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Fibronectin (2755-8), Biotin conjugate, 0.1mg/mL
BNCB0091-500 1x 500 µL

Fibronectin (2755-8), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF405S conjugate, 0.1mg/mL
BNC041631-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details