Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

This Recombinant Mouse Toll-like receptor 7 (Tlr7), partial spans the amino acid sequence from region 27-348aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P58681

Expression Region

27-348aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL19/MIP-3 beta ELISA Kit
EA100316 96 Well

Human CCL19/MIP-3 beta ELISA Kit

Sign In for Pricing
View Details
OR2M7 Antibody
8G563-AAT 50 µg

OR2M7 Antibody

Sign In for Pricing
View Details
ARL13A (NM_001162490) Human Over-expression Lysate
LC431253 20 µg

ARL13A (NM_001162490) Human Over-expression Lysate

Sign In for Pricing
View Details
RASSF10 (Center) Rabbit Polyclonal Antibody
AP53592PU-N 400 µL

RASSF10 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C7orf61 (NM_001004323) Human Recombinant Protein
TP307300L 1 mg

C7orf61 (NM_001004323) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]
AN00323L-01 20 Tests

Elab Fluor® 488 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details