Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)

This Recombinant Mouse CD40 ligand (Cd40lg), partial (Active) spans the amino acid sequence from region 112-260aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD40 ligand; CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP) ; Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5

UniProt

P27548

Expression Region

112-260aa

Tag

N-terminal mFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40 at 2 μg/mL can bind Mouse Cd40lg. The EC50 is 5.121-6.085 ng/mL.

Form

Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPFH1 shRNA Plasmid (h)
sc-90434-SH 20 µg

SPFH1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human SNX15 Protein - (Dry Ice)
H00029907-P01-25ug 25 µg

Recombinant Human SNX15 Protein - (Dry Ice)

Sign In for Pricing
View Details
DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (Azide free) (HRP)
MBS6472993-01 0.2 mL

DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (Azide free) (HRP)

Sign In for Pricing
View Details
DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (Azide free) (HRP)
MBS6472993-02 5x 0.2 mL

DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (Azide free) (HRP)

Sign In for Pricing
View Details
Research Grade Obrixtamig
HP628056-01 100 µg

Research Grade Obrixtamig

Sign In for Pricing
View Details
Research Grade Obrixtamig
HP628056-02 1 mg

Research Grade Obrixtamig

Sign In for Pricing
View Details