Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40 ligand (Cd40lg), partial

This Recombinant Mouse CD40 ligand (Cd40lg), partial spans the amino acid sequence from region 112-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD40-L; T-cell antigen Gp39; TNF-related activation protein (TRAP) ; Tumor necrosis factor ligand superfamily member 5

UniProt

P27548

Expression Region

112-260aa

Tag

N-terminal mFc1-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Rabbit Polyclonal Antibody
AP08083PU-N 100 µL

AKT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]
TA811794AM 100 µL

RPL7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]

Sign In for Pricing
View Details
DEFB132 (NM_207469) Human Over-expression Lysate
LY404044 100 µg

DEFB132 (NM_207469) Human Over-expression Lysate

Sign In for Pricing
View Details
FABP4 Goat Polyclonal Antibody
AP32740PU-N 100 µg

FABP4 Goat Polyclonal Antibody

Sign In for Pricing
View Details
N-Nitroso Simazine
TRC-N546680-1G 1 g

N-Nitroso Simazine

Sign In for Pricing
View Details
ErbB 3 (ERBB3) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11A4]
AM00054PU-N 100 µg

ErbB 3 (ERBB3) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11A4]

Sign In for Pricing
View Details