Recombinant Human Interleukin-13 (IL13) (Active)
This Recombinant Human Interleukin-13 (IL13) (Active) spans the amino acid sequence from region 21-132aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Expression Region
21-132aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 2.045-6.215 ng/mL.
Form
Lyophilized powder
Molecular Weight
13.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-28744-50ug 50 µg
CHO Monoclonal TrkB Antibody (Rinat patent anti-TrkB) - Humanized, IgG2SA - (Dry Ice)
Sign In for Pricing
View Details