Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombopoietin (THPO) (Active)

This Recombinant Human Thrombopoietin (THPO) (Active) spans the amino acid sequence from region 22-353aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombopoietin; C-mpl ligand (ML) ; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor (MGDF) ; Myeloproliferative leukemia virus oncogene ligand; THPO; MGDF

UniProt

P40225

Expression Region

22-353aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 0.4353 - 1.089 ng/mL.

Form

Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS651752 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-01 50 μL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-02 100 µL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-03 1 mL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
AKAP2 Human Gene Knockout Kit (CRISPR)
KN217988 1 Kit

AKAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one
TRC-A604380-1MG 1 mg

(S)-7-Amino-5H,7H-dibenzo[b,d]azepin-6-one

Sign In for Pricing
View Details