Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)

This Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active) spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b

UniProt

P40259

Expression Region

29-159aa

Tag

C-terminal 10xHis-mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 31.97-35.69 ng/mL.

Form

Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP013, NT (C16orf13, UPF0585 protein C16orf13) (FITC) discontinued
034151-FITC 200 µL

CP013, NT (C16orf13, UPF0585 protein C16orf13) (FITC) discontinued

Sign In for Pricing
View Details
Anti- G protein-coupled receptor 101 Antibody
GWB-447E37 0.05 mL

Anti- G protein-coupled receptor 101 Antibody

Sign In for Pricing
View Details
Flavin Adenine Dinucleotide (FAD) Antibody (Biotin)
abx274587-01 200 µL

Flavin Adenine Dinucleotide (FAD) Antibody (Biotin)

Sign In for Pricing
View Details
Flavin Adenine Dinucleotide (FAD) Antibody (Biotin)
abx274587-02 1 mL

Flavin Adenine Dinucleotide (FAD) Antibody (Biotin)

Sign In for Pricing
View Details
NME4 Recombinant Protein Antigen
NBP2-57471PEP 100 µL

NME4 Recombinant Protein Antigen

Sign In for Pricing
View Details
BEND4 Human siRNA Oligo Duplex (Locus ID 389206)
SR318060 1 Kit

BEND4 Human siRNA Oligo Duplex (Locus ID 389206)

Sign In for Pricing
View Details