Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

This Recombinant Human CD79A&CD79B Heterodimer Protein (Active) spans the amino acid sequence from region 33-143aa&29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P40259, P11912

Expression Region

33-143aa&29-159aa

Tag

C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 8.012-9.339 ng/mL. 2Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 14.85-17.47 ng/mL.

Form

Lyophilized powder

Molecular Weight

41.3 kDa&43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RGS22 Antibody [mFluor Violet 610 SE]
NBP3-06371MFV610 0.1 mL

Rabbit Polyclonal RGS22 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MCF2L2 siRNA (Human)
orb1860259-01 15 nmol

MCF2L2 siRNA (Human)

Sign In for Pricing
View Details
MCF2L2 siRNA (Human)
orb1860259-02 30 nmol

MCF2L2 siRNA (Human)

Sign In for Pricing
View Details
Mouse Fosl1 ELISA Kit
EF014963 96 Tests

Mouse Fosl1 ELISA Kit

Sign In for Pricing
View Details
Human Thymic stromal lymphopoietin / TSLP
IT-300-166p-01 0.1 mg

Human Thymic stromal lymphopoietin / TSLP

Sign In for Pricing
View Details
Human Thymic stromal lymphopoietin / TSLP
IT-300-166p-02 1 mg

Human Thymic stromal lymphopoietin / TSLP

Sign In for Pricing
View Details