Recombinant Bacillus phage phi29 Histone-like protein p6 (6)
This Recombinant Bacillus phage phi29 Histone-like protein p6 (6) spans the amino acid sequence from region 1-104aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Double-stranded DNA-binding protein p6; Gene product 6; gp6; Nucleoid-associated protein p6; Protein p6
UniProt
P03685
Expression Region
1-104aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Bacillus phage phi29 (Bacteriophage phi-29)
Field of Research
Infectious Disease & Virology; Epigenetics & Chromatin
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAKMMQREITKTTVNVAKMVMVDGEVQVEQLPSETFVGNLTMEQAQWRMKRKYKGEPVQVVSVEPNTEVYELPVEKFLEVATVRVEKDEDQEEQTEAPEEQVAE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TIMP2 Mouse Monoclonal Antibody [Clone:1B11]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
46100154 3x 1.0 µg DNA
TAGAP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details