Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative BCoR-like protein 2 (BCORP1)

This Recombinant Human Putative BCoR-like protein 2 (BCORP1) spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BCL-6 corepressor pseudogene 1; BCL-6 corepressor-like protein 2

UniProt

Q8N888

Expression Region

1-145aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKEKLSKKRAEVKGNRSWLEEFLKPSDNEEGPPPKNKVLSNNASSQKPTHSSCIPLLRLPDKQQKVNESIKTDMLCTDKEEECPAASLLQKYTNNSEKPSGKRQCKTKHLISQDLRQGFLLTGKCYVENADGKIPLGTCFLLGLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Hydroxy PEG
112000-0.5G 5 g

α, ω-Bis-Hydroxy PEG

Sign In for Pricing
View Details
Cy5DIGE NHS ester
25306-AAT 100 nmoles

Cy5DIGE NHS ester

Sign In for Pricing
View Details
PTK7 Antibody
KC-2224-01 50 μL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-2224-02 100 µL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-2224-03 1 mL

PTK7 Antibody

Sign In for Pricing
View Details
Olfr472 Rabbit Polyclonal Antibody
TA363577 100 µL

Olfr472 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details